SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011941 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011941
Domain Number 1 Region: 7-57
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000442
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 2 Region: 409-443
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000085
Family CCCH zinc finger 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011941   Gene: ENSOPRG00000013068   Transcript: ENSOPRT00000013087
Sequence length 1125
Comment pep:novel genescaffold:pika:GeneScaffold_1557:150671:214155:-1 gene:ENSOPRG00000013068 transcript:ENSOPRT00000013087 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQAPQWTDFLSCPICTQTFDETIRKPISLGCGHTVCKMCLNKLHRKACPFDQTTINTDI
ELLPVNSALLQLVGAQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGL
NSTTQSVLSRPMQRKLVTLVHCQLVEEEGRIRAMRSARSLGGXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXMQEEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTS
IGHVVQLLYRASCFKVTKRDEDSSLMQLKEEFRTYEALRREHDSQIVQIAMEAGLRIAPD
QWSSLLYGDQSHKSHMQSIIDKLQTPASFAQSVQELTIALQRTGDPANLNRLRPHLELLA
NIDPSPDAPPPTWEQLENGLVAVRTVVHGLVDYIQNHSKKGADQQQAPQHSKYKTYMCRD
MKQRGGCPRGASCTFAHSQEELEKFRKMNKRLAPRRPLSASLGQLNEVGLPSAAILPDET
AVELPDRKPPALPNGIVSAGGSATQLIPRGTDPSYDAGLKPGKLDHLSSSAPGSPPDLLE
SVPKSISALPVNPHPVPPRGPADLPPMPVTKPLQMVPRGSQLYPAQQADVYYQDPRGAAP
PFEPAPYQQGVYYTAPPPCVSRFVRPAPSAPEPGPPCLDHYPAYLQDRVMSSQYGTQPQQ
YPPVYPPHYDGRRVYPAQSYTREEIFRESPIPIEVPPAPVPSYVPESRERYQQMEGYYPV
APHPSQIRAPYPREPPYSRLPPPPQPHPSLDELHRRRKEIMAQLEERKVISPSFAPSHMP
PAFHQGFLDEDLKAAGKYKGNDYSQYSPWSCDTIGSYIGTKDAKPKDAVAAGSMEMMNME
GKGVRDPRLDPQRRAAEASDDDLIPFGDRPTVSRFGAISRTSKTIYQGAGPMQAMVPAGA
PTKSLGISDYSPYGSHAAWGGSPYSPHQNMPSQGHFGERERIPMSEVGGHGKPLPCADRE
QLRLELQQLNHQISQQSQLRGLEAVSNRLLLQREASTVGQPQPPPLPKWSMISSEQLSLX
XXXXXXXXXXXXXXXXXENQCSLDMKSKLNASKQTENGQAEPQAKGPAEDLTLTFSDVPN
GSALTQENASLLSSKTSSLKLSEDPEAGGDNSGCQRPGMPPSAAP
Download sequence
Identical sequences ENSOPRP00000011941 ENSOPRP00000011941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]