SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012250 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012250
Domain Number 1 Region: 37-173
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-36
Family C-type lectin domain 0.00000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012250   Gene: ENSOPRG00000013433   Transcript: ENSOPRT00000013422
Sequence length 174
Comment pep:novel scaffold:pika:scaffold_5690:4774:6795:1 gene:ENSOPRG00000013433 transcript:ENSOPRT00000013422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLPTALPRVSWMLSCLMILSQVQGEDSQSEMGSPSINCPKGTKTYGSFCYAVFTTPKTW
MDAELDCQKRPLGNLVSVLNRAEASFVSSLIRSTVNSHQFIWLGLSDPTEASEPNGGGWE
WSSTDLLRYTAWDTIPSNAKDRGFCASLSRSSKFLKWRDYNCDLQLPYVCKFKY
Download sequence
Identical sequences XP_004590847.1.84141 ENSOPRP00000012250 ENSOPRP00000012250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]