SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012286 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012286
Domain Number 1 Region: 537-653
Classification Level Classification E-value
Superfamily SEA domain 5.1e-18
Family SEA domain 0.0069
Further Details:      
 
Domain Number 2 Region: 214-308
Classification Level Classification E-value
Superfamily SEA domain 0.00000000222
Family SEA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012286   Gene: ENSOPRG00000013463   Transcript: ENSOPRT00000013462
Sequence length 766
Comment pep:novel genescaffold:pika:GeneScaffold_1272:26920:120272:-1 gene:ENSOPRG00000013463 transcript:ENSOPRT00000013462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IAIKIHHSETKDTDNVPRLETESSSNTHKMSTTMKRIFDLAKQRTKRSAFFPSAAKICPQ
ESMQQILAGLQAYYRLRVCQEAVWEAYRIFLDRIPDPGEYQNWVDLCQRETFCLFDIGKN
FSSSQEHLNLLKQRIKHRSFSEXXXXXXXXXXXXXXXXXXXXXXXVASLAPLLPSPVDTH
LNEILNHTLKETKKPPTERETWRHNVSKDLLEKVEFSISLANQKFKAELSDSQSPYYQEV
AVKSQLQMQKAFKKLPGFKEIHVLGFRPKKERDGSSSTQIQLMAIFKKDSTEAKSPASHF
QSIDSNTLESGIHHGTKEEHKQPEISLTATNLQVLISRVLEEDQSLDVRTIQFTDXXXXX
XXXXXXXXXXXXXXXXXXXXXDATLSPELSLGVPVLETMDRTEHGLSDSSWSSPAMASAS
LSETPFFTTPSIFSLADESTTELMSIDQTLLVPTSEYSAISQVTLGISYSPVSSDDSRLS
MDSQATTRDLDVTALSNTPAFSEDPGLNGSVSTLDHFLENPTSAPALQYVTTSSMTIATR
GQELVVFFSLRVANMPFSNDLFNKSSLEYQTLEQRFTQLLVPYLQANLTGFKQLEILNFR
NGSVIVNSRMRFAKSVPYNLTKAVHSILEDFRSTAAQQLDLEIDDYSLNVEPADQADPCK
FLACGEFAQCVKNEWTDEVECHCKPGHPSQGDVARSNSGLCAPGGECDVVQGKGVPCXXX
XXXXXXXXXXXXXXXXXXXXXXVTRKRKSESPTVEEEFNHPDWQRN
Download sequence
Identical sequences ENSOPRP00000012286 ENSOPRP00000012286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]