SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012362 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012362
Domain Number 1 Region: 427-562
Classification Level Classification E-value
Superfamily TIMP-like 1.22e-31
Family Netrin-like domain (NTR/C345C module) 0.034
Further Details:      
 
Domain Number 2 Region: 204-299
Classification Level Classification E-value
Superfamily Immunoglobulin 2.53e-20
Family I set domains 0.019
Further Details:      
 
Domain Number 3 Region: 380-432
Classification Level Classification E-value
Superfamily BPTI-like 3.12e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0028
Further Details:      
 
Domain Number 4 Region: 319-375
Classification Level Classification E-value
Superfamily BPTI-like 1.99e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.012
Further Details:      
 
Domain Number 5 Region: 118-168
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000134
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 33-83
Classification Level Classification E-value
Superfamily Elafin-like 0.000000301
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012362   Gene: ENSOPRG00000013566   Transcript: ENSOPRT00000013547
Sequence length 571
Comment pep:novel genescaffold:pika:GeneScaffold_1127:703958:707845:1 gene:ENSOPRG00000013566 transcript:ENSOPRT00000013547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQALGCHRLWPHCGLLLLLLLGMPPRGLAPPPIRYSHAGICPNDMNPNLWVDAQSTCKRE
CETDQECETYEKCCPNVCGTKSCVAARYMDVRGKKGPVGMPREATCDHFMCLQQGSECDV
WDGQPVCKCRDRCEKEPSFTCASDGLTYYNRCYMDAEACSKGITLAVVTCRYHFTWPNTS
PPPPETTVYPTTASPETPGLDLAAPALLNHPIHQSVTVGETVSFLCDVVGRPRPEISWEK
QLEDRENVVMWPNHVRGNVAVTNIAQLVIYNAQLQDAGIYTCTARNAAGVLRADFPLSVV
RPGQATTTSENSPNGTAFPAAECLQPPDGEDCGEEQTRWHFDAQANNCLTFTYGHCHRNL
NHFETYEACMLACMSGPLAVCSLPALQGPCKAYAPRWAYNRQMGQCQSFVYGGCEGNGNN
FESREACEESCPFPRGNQRCRACKPRQKLVTSFCRSDFVILGRVSELTEEPDSGRALVTV
DEVLKDEKMGLRFLGREPLEVTLLQVDWACPCPNVTVGETPLIIMGEVDGGMATLRPDSF
VGASSTRRVRKLHEVMHKKTCEVLKELLALA
Download sequence
Identical sequences ENSOPRP00000012362 ENSOPRP00000012362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]