SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013240 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013240
Domain Number 1 Region: 633-828
Classification Level Classification E-value
Superfamily Sec7 domain 5.36e-73
Family Sec7 domain 0.0000019
Further Details:      
 
Domain Number 2 Region: 402-579,1088-1474,1647-1755
Classification Level Classification E-value
Superfamily ARM repeat 4.91e-28
Family Armadillo repeat 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013240   Gene: ENSOPRG00000014468   Transcript: ENSOPRT00000014507
Sequence length 1784
Comment pep:novel genescaffold:pika:GeneScaffold_1696:204524:351755:1 gene:ENSOPRG00000014468 transcript:ENSOPRT00000014507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQESQTKSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAEIEKQRLGAAAPPKA
NFIEADKYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVE
TICNCFQGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQT
TAKATLTQMLNVIFTRMENQVLQEARELEKPVQSKPQSPVIQAAAVSPKFSRWKQSQAQS
KPTTPEKADLTNGEHVGDGSGRVSAENGDPHRERAVSLSGLEDGAQEVVKDILEDVVASA
VKEAAEKHGVTEPERGLGDLEQDSGGPPGVDENSQTNGIADDRQSLSSADNLESDAQGHQ
VAARFSHILQKDAFLVFRSLCKLSMKPLGEGPPDPKSHELRSKVVSLQLLLSVLQNAGPV
FRTHEMFINAIKQYLCVALSKNGVSSVPDVFELSLAIFLTLLSNFKMHLKMQIEVFFKEI
FLNILETSTSSFEHRWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIA
QGRSGHELGMTPLQELSLRKKGLECLVSILKCMVEWSKDLYVNPNHQTSVGQERLLDQEM
GDGKGLDMGRRSSVTSMESTVSSGTQTAIQDDPEQFEVIKQQKEIIEHGIELFNKKPKRG
IQFLQEQGMLGTSVDDIAQFLHQEERLDSTQVGDFLGESTRFNKEVMYAYVDQLDFCEKE
FVSALRTFLEGFRLPGEAQKIDRLMEKFAARYIECNQGQTLFASADTAYVLAYSIIMLTT
DLHSPQVKNKMTKEQYIKMNRGIDDSKDLPEEYLSGIYEEIEGKKIAMRETKEHTIASKS
TKQSVASEKQRRLLYNLEMEQMAKTAKALMEAVSHAKAPFTSATHLDHVRPMFKLVWTPL
LAAYSIGLQNCDDTEVASLCLEGIRCAIRIACIFGMQLERDAYVQALARFSLLTASSSIT
EMKQKNIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKTRYLSGSGRER
EGSLKGHTLAGEEFMGLGLGTLVSGGVDKRQMASFQESVGETSSQSVVVAVDRIFTGSTR
LDGNAIVDFVRWLCAVSMDELASPHHPRMFSLQKIVEISYYNMNRIRLQWSRIWHVIGDH
FNKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIRD
MVIRCIAQMVNSQAANIRSGWKNIFAVFHQAASDHDGNIVELAFQTTGHIVTNIFQHHFP
AAIDSFQDAVKCLSEFACNAAFPDTSMEAIRLIRFCGKYVSERPRVLQEYTSDDMNVAPG
DRVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWQDLFRIVFRI
FDNMKLPEQQSEKSEWMTTTCNHALYAICDVFTQFYEALNEVLLSDVFAQLQWCVKQDNE
QLARSGTNCLENLVISNGEKFSVAVWDETCSCMRDIFQTTIPHVLLTWRPAGMEDDSTEK
PWXXXXXXXXXXXXDKNASERGQSQLSNPTDDSWKGRPYANQKLFASLLIKCVVQLELIQ
TIDNIVFYPATSKKEDAEHMVAAQQDTLDADIHIETEDQGMYKYMSSQHLFKLLDCLQES
HSFSKAFNSNYEQRTVLWRAGFKGKSKPNLLKQETSSLACCLRILFRMYVDENRRDSWEE
IQQRLLTVCSEALAYFITVNSESHREAWTSLLLLLLTKTLKINDEKFKAHASKYYPYLCE
IMQFDLIPELRAVLRKFFLRIGVVYKIWIPEEPPQVPATLSPAW
Download sequence
Identical sequences ENSOPRP00000013240 ENSOPRP00000013240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]