SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013611 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013611
Domain Number 1 Region: 445-500
Classification Level Classification E-value
Superfamily CCCH zinc finger 2.09e-21
Family CCCH zinc finger 0.000029
Further Details:      
 
Domain Number 2 Region: 417-443
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000085
Family CCCH zinc finger 0.00041
Further Details:      
 
Domain Number 3 Region: 389-414
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000942
Family CCCH zinc finger 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013611   Gene: ENSOPRG00000014889   Transcript: ENSOPRT00000014906
Sequence length 1244
Comment pep:novel genescaffold:pika:GeneScaffold_3310:186845:222847:-1 gene:ENSOPRG00000014889 transcript:ENSOPRT00000014906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAPETPPPPPSESPPPPSPPPPSTPSPPPCSPDARPATPHLLHHRLPLPDDREDGELE
EGELEDDGAEEMQDTSGGPERSRKEKGEKHHSDSDEEKSHRRLKRKRKKEREKEKRRSKK
RRKSKHKRHASSSDDFSDFSDDSDFSPSEKSHRKYREYSPPYAPSHQQYSSSHTTPLPKK
SYSKMDSKSYSMYEDYENEQYGEYEGDEEEDMGKEDYDDFTKELNQYRRAKEGSSRGRGS
RGRGRGYRGRGSRGGSRGRGLGRGSRGRGRGSGGDHPEDEEDFYDEEMEYGESEEPLGDD
DYDEYSKELNQYRRSKDSRGRGLSRGRGRGSRGRGKGMGRGRGRGGSRGGMSKGGMNDED
DFYDEDIGQDGGGSYRRSDHDKPHQQSDKKGKVICKYFVEGRCTWGDHCNFSHDIELPKK
RELCKFYITGFCARAENCPYMHGDFPCKLYHTTGNCINGDDCMFSHDPLTEETRELLDKM
LADDAEAGAEDEKEVEELKKQGINPLPKPPPGVGLLPTPPRPPGPPAPTSPNGRPMQGGP
PPPPPPPPPPPGPPPMPMPVHEPLSPQQLQQQQDMYNKKIPSLFEIVVRPTGQLAEKLGV
RFPGPGAPPGPMGPGPNMGPPGPMGGPMHPDMHPDMHPDMHPDMHPDMPMGPGMNPGPPL
GPGGPPMMPYGPGDSPPSGMMPPIPPAQSFYENFYQQQEGMEMEQGLMGDAXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXDTGNWYSSDEDEGGSSMTSILKTLRQQTSSRPQTAAGLSGSGLG
DPRLQKGHSTGSRLADPRLSRDPRLSRHAEAAAGPGLGDTGPCDPRLARSLPAXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPLPGHPLRDPRSQLQQFSHIKKD
VTLSRPTFARNVLWNPEDLIPLPVPKQDVVPPVPAALQAMPTLDPRLHRSTSSGPPSARQ
RPGTSADSSVPGSNLPDFELLSRILKTVNATGPSSTAPGTSDKPSDPRVRKTPTDPRLQK
PADPTASRAAKPSPPEAASPSSSPSGSSPPATAPYDPRLLAAGGLGQGSSCGQSSVLSGI
SLYDPRTLNAGGKATEPAAEAGAQPKGTEGNGKGATSKAKEPPFIRKSALEQPEAGKASS
AEGGRTTDRYNSYNRPRPKTTDPAGATATPLSGTAPNWVHSLPV
Download sequence
Identical sequences ENSOPRP00000013611 ENSOPRP00000013611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]