SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013965 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013965
Domain Number 1 Region: 561-838
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.79e-79
Family Protein kinases, catalytic subunit 0.00000000064
Further Details:      
 
Domain Number 2 Region: 2-149
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.38e-52
Family Ephrin receptor ligand binding domain 0.0000000734
Further Details:      
 
Domain Number 3 Region: 857-924
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.3e-19
Family SAM (sterile alpha motif) domain 0.00027
Further Details:      
 
Domain Number 4 Region: 387-479
Classification Level Classification E-value
Superfamily Fibronectin type III 2.2e-16
Family Fibronectin type III 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013965   Gene: ENSOPRG00000015286   Transcript: ENSOPRT00000015286
Sequence length 938
Comment pep:novel genescaffold:pika:GeneScaffold_2801:328700:341126:-1 gene:ENSOPRG00000015286 transcript:ENSOPRT00000015286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDEEQHSVRTYEVCDLQRTPGTAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSC
KETFTVFYYESDADTATALTPAWMENPYIKVDTVAAEHLTRKRPGTKGTGKVNIKTLRLG
PLSKAGFYLAFQDQGACMALLSLHLFYKKCAQLTLNLTYFPETVPRELVVPVAGICVADA
VPAPGPNPSLYCREDGQWAEQPVTGCSCGPGFEAAEGNTKCRXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDY
EVKYHEKGAEGPSSVRFLKTSERAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQL
DEGDNWREQLALITGTAVVGVVLVLVVVVIAILCLRKQSSGRDVEYSDKHGQYLIGHGTK
VYIDPFTYEDPNEAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKT
LKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSVPVMILTEFMENGALDSFLRLN
DGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEEN
SSDPTYTSSLGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQD
VINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVA
RENGGASHPLLDQRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLL
RIGVTLAGHQKKILASVQHMKSQAKASTPGATAGPTPP
Download sequence
Identical sequences ENSOPRP00000013965 ENSOPRP00000013965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]