SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014051 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014051
Domain Number 1 Region: 124-268
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-36
Family C-type lectin domain 0.000000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014051   Gene: ENSOPRG00000015391   Transcript: ENSOPRT00000015383
Sequence length 272
Comment pep:novel genescaffold:pika:GeneScaffold_5227:102774:112942:-1 gene:ENSOPRG00000015391 transcript:ENSOPRT00000015383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFEDLKAKPMKDHPDEQSNRKKGKGLGCLSSPWWCLAAVSLGIVCLGLLVTIAMLGMQL
LQVSDLLKQQQANLTLQESMLEEQLLAQQQREAASQESQKELKNMIGTLAKQLQEKTEAE
TELNRQYLTLQEALKRMENFSGPCPQDWLWHEKNCYLFSSGSYNWEKSKERCLSLDAQLL
TINSTEDLDFIQQTISHSNFPFWLGLSQRKPNYSWLWEDGSPLMPHLFRFQGAVSQRYPS
GTCAYIQRGNIFAENCILVAYSICQKKAELLT
Download sequence
Identical sequences ENSOPRP00000014051 ENSOPRP00000014051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]