SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014286 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014286
Domain Number 1 Region: 6-101
Classification Level Classification E-value
Superfamily Hormone receptor domain 7.19e-27
Family Hormone receptor domain 0.0000792
Further Details:      
 
Domain Number 2 Region: 173-378
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000915
Family Rhodopsin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014286   Gene: ENSOPRG00000015624   Transcript: ENSOPRT00000015638
Sequence length 407
Comment pep:novel genescaffold:pika:GeneScaffold_328:246638:260964:1 gene:ENSOPRG00000015624 transcript:ENSOPRT00000015638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DQHCESLSLASNTSGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRE
CLANGSWAARVNYSACQEILNEEKKSKVHYHVAVIINYLGHCVSLAALLVAFVLFLRLRP
GKGNAGGTLEAGPLQLMSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEAHQSNVGWC
RLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAI
GKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQ
YRKAVKATLVLLPLLGITYMLFFVHPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNS
EVRSAIRKRWHRWQDKHSIRARVARAMSIPTSPTRISFHSIKQSTAV
Download sequence
Identical sequences ENSOPRP00000014286 ENSOPRP00000014286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]