SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014428 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014428
Domain Number 1 Region: 254-562
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.69e-97
Family Transglutaminase core 0.0000000932
Further Details:      
 
Domain Number 2 Region: 106-253
Classification Level Classification E-value
Superfamily E set domains 7.35e-45
Family Transglutaminase N-terminal domain 0.00011
Further Details:      
 
Domain Number 3 Region: 576-687
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.66e-29
Family Transglutaminase, two C-terminal domains 0.00057
Further Details:      
 
Domain Number 4 Region: 688-787
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.46e-25
Family Transglutaminase, two C-terminal domains 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014428   Gene: ENSOPRG00000015786   Transcript: ENSOPRT00000015792
Sequence length 815
Comment pep:novel genescaffold:pika:GeneScaffold_5453:18597:35375:-1 gene:ENSOPRG00000015786 transcript:ENSOPRT00000015792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMDGSRSDMGRSDMGRWRGGPLQPSATPSPEPEPEPEPDRRSRGRGGGGGRSFWARCCGC
CSCRNSTDDDWGREPSDSRGRGSSSRGGRPDSRGGGVNAAGDGTIREGMLVVTGVDLLSN
RSDQNRREHHTDEFEYDELIVRRGQPFHLVLFLSRSYESSDRIALELQIGNNPEVGKGTH
VIIPVGRGGSGGWKAQVTKSSGQSLNLRVHTSPSAIIGKFQFTVRTRTEAGEFQLPFDPR
NEIYILFNPWCPDDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDA
CLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVE
ILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDEN
MKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPETSRXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAISSNMREDIT
HIYKHPEGSDAERKAVETAAAHGSKPNVYATRDSAEDVAMQVEAQDAVMGQDLTVSVVLN
NRGSSSRTVKLHLYLSVTFYTGVTGTIFKESKKEVVLPPGASDRVTMPVAYKEYRPHLVD
QGAMLLNVSGHVKESGQVLAKQHTFRVRTPDLSLTLLGAAVVGQECEVQIVFKNPLPITL
TNVVFRLEGSGLQRPKILNVGXXXXXXXXXXXXXFVPVRPGPRQLIASLDSPQLSQVHGV
IQVDVAPASGGRGFSDTAGDNFSGETIPMMSRGEA
Download sequence
Identical sequences ENSOPRP00000014428 ENSOPRP00000014428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]