SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015107 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015107
Domain Number 1 Region: 39-218
Classification Level Classification E-value
Superfamily Serpins 0.00000000000072
Family Serpins 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000015107
Domain Number - Region: 338-386
Classification Level Classification E-value
Superfamily Serpins 0.000327
Family Serpins 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015107   Gene: ENSOPRG00000016544   Transcript: ENSOPRT00000016545
Sequence length 386
Comment pep:novel genescaffold:pika:GeneScaffold_5313:105126:108890:-1 gene:ENSOPRG00000016544 transcript:ENSOPRT00000016545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQNSAILEMAPASVSLGLTIICLLTLSGPAASDRVYIHPFHLLFYSKSSCDQLEKADAQT
PKEPTFTPVPIQAKTAPVDEAALHDQLVLAAKKLRAEDRLGATKVGMLVNVLGLRMYRTL
SETWDNPRGAVLSPVPLFGTLASLYLGASDHTATQLQSFLAVPGEDLGCTSRLDGNKVLS
ALQAIQSLVMTHHRSQAPLLLSTEVGLFTATHLRVKPLMLNLSTFCRVMSSSVEFLPPDF
DVKIRIQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAIHLTMPQLLLQGSYSLQDLLA
HAKLPTLLGAEANLNKISDADVRVGK
Download sequence
Identical sequences ENSOPRP00000015107 ENSOPRP00000015107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]