SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015340 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015340
Domain Number 1 Region: 40-197
Classification Level Classification E-value
Superfamily C-type lectin-like 9.1e-36
Family C-type lectin domain 0.00000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015340   Gene: ENSOPRG00000016800   Transcript: ENSOPRT00000016797
Sequence length 199
Comment pep:novel genescaffold:pika:GeneScaffold_4260:154596:161185:-1 gene:ENSOPRG00000016800 transcript:ENSOPRT00000016797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSEGCSLTENSSLHLERGQQNDATHSHFTTHHEGSLQVPIPCAVMGVVFTTILIIALIA
LSVGKYNCPGQFSVPAPEGAASSCSDDWVGYQRKCYYFSAETHSWPLALKSCSRLGATLA
VIDSEKDMIFLKRYVGRTDHWIGLKKEADQSWKWSNGKEFNNWFNFTGSENCAFLNSASI
GSTECERNLHWICSKPSKE
Download sequence
Identical sequences ENSOPRP00000015340 ENSOPRP00000015340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]