SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|58039473|ref|YP_191437.1| from Gluconobacter oxydans 621H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|58039473|ref|YP_191437.1|
Domain Number 1 Region: 214-469
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.13e-54
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000836
Further Details:      
 
Domain Number 2 Region: 81-174
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 3.84e-34
Family Glycosyl hydrolases family 32 N-terminal domain 0.00033
Further Details:      
 
Domain Number 3 Region: 472-638
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.7e-22
Family Glycosyl hydrolases family 32 C-terminal domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|58039473|ref|YP_191437.1|
Sequence length 646
Comment levanase [Gluconobacter oxydans 621H]
Sequence
MTDHNDLPVPGRRRALTSLLAAGTVAGTVGSSLRLTGNASAADEPPKDALTPHGHQPSNA
HIEPADQPGANNKPVIRTQSDYFYRPSIHFSPPTGFMNDPNGLIFDGQTYHLYYQYDPTA
PYAGRVHWGHATSTDLYTWQDQPIAIDQTAAGEAYTGCVVLDRNNVSGLFPPRKPEAAAA
PPATPTATQTAVQALAPELRKTTSDTPYAPDKMPALGPNESAPFGSVYAPSSSAETHAAP
PALPPMPGGLVAIYTRATPQSQTQYIAWSPDGGQHYIDYDHNPILNIGVNSFRDPKVFWH
EASGKWIMVVVSARAHKVLFYGSIDLLHWMHLSSFGPAGLFGVDYECPNLIELDIEGDEK
GRRWVLFVSVNPGGPLGGSVTQYFVGDFDGERFTPDNTVIGLTDFAKDSYAMQVYDSMPD
NKAVYFAWFGNWQYCEEVPNRSWRGLMTLPRRMFLRRDEMNWLRLVQRPYGLEAFRGEKI
PFKVERIAAQSGVQVALPTGTAIELLLTVTVDERSNPQPDGEQGRAGRFVIVFSNGQGES
LSIGFDAFSSQLWLDRGDLHGFSQPFFTERFSTPLIANSRRFSLRLVLDACALELFANDG
LSVATALVFPANPLTTLGLQATNTGATIEELALYPLRKTMDRPTAL
Download sequence
Identical sequences Q5FS65
gi|58039473|ref|YP_191437.1| 290633.GOX1010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]