SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Ost9901_3|17428|fgenesh1_pg.C_Chr_11000230 from Ostreococcus lucimarinus CCE9901

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Ost9901_3|17428|fgenesh1_pg.C_Chr_11000230
Domain Number 1 Region: 12-559
Classification Level Classification E-value
Superfamily SIS domain 1.56e-181
Family Phosphoglucose isomerase, PGI 0.000000000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Ost9901_3|17428|fgenesh1_pg.C_Chr_11000230
Sequence length 590
Sequence
MGTQGGTALISTTAEWRALKEHFANEIDKTHLRDLIADAKRCEELVIESDGVYCDFARQR
VTHDTMTKLYDLARAAGVKEKINAMFNGEAINSTENRAVLHVATRAPKDKVINVDGKNVV
PDVHDVLDKIKDFSERVRNGEWVGETGKPLKDVVAIGIGGSFLGPLFVHTSLRTNPEAAD
EARGRQLRFLANVDPVDVARSLNGLDPETTLVIVVSKTFTTAETMLNARTVRAWIRASLG
EAAVSKHMVAISTNLKLVEEFGIDPDNAFAFWDWVGGRYSVCSAVGMLPLSLQYGYDTME
QFLKGAWSMDQHFANAPFEKNLPLTLGMLSVWNVSFLDCPARAILPYTQALAKLAPHIQQ
VAMESNGKGVAIDGTPLDYETGEIDFGEPGTNGQHSFYQLIHQGRTIPCDFIGIIKSQQS
VYLKGEIVSNHDELMCNFFAQADALAVGKSAIELRAESCPDALIPHKTFTGNRPSLSILL
PELNAYTTGQLLSLYEHRVATQGFVWGLNSFDQWGVELGKVLASRVRTSMNSKRTKGEIM
TPGDGFNPSTTALLNRYLAGKAKLIYPEPKDVFPCDLIDGDECRPPTSYV
Download sequence
Identical sequences A4S521
jgi|Ost9901_3|17428|fgenesh1_pg.C_Chr_11000230 XP_001420367.1.19716 436017.A4S521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]