SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Ost9901_3|31870|eugene.0500010407 from Ostreococcus lucimarinus CCE9901

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Ost9901_3|31870|eugene.0500010407
Domain Number 1 Region: 316-686
Classification Level Classification E-value
Superfamily SIS domain 1.02e-96
Family double-SIS domain 0.000000486
Further Details:      
 
Domain Number 2 Region: 2-275
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.06e-55
Family Class II glutamine amidotransferases 0.00000911
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Ost9901_3|31870|eugene.0500010407
Sequence length 686
Sequence
MCGIFAYSNWNCPKSQKEIVEKLLTGLKRLEYRGYDSAGLALEDGEDVSRTTAKVFRETG
KIANLEGLLEASEKDLHGDLVFESHCGIAHTRWATHGPPAPKNSHPHTSDEENDFLVVHN
GIITNHQALRETLQRKGYMFESDTDTEVIPKLTKYLFDKFHDKCSFRQLVMEVLRQLHGA
YALAFKSRHYPGELVAAKRGSPLLLGIAEGPHPGEQHALVTSEGFVPTSKRAKRTSMEFY
FASDASAMVEHTKRVLHLEDDDVAHIHNGGYGIYRMEKIHTEGEDSPSLAYAPTVKSAEV
ERTIETLTMEVEQIMKGNFDHFMKKEIHEQPDAIQQTMRGRVVFDADGNVQRVFLGGMVD
YLSTIRRSRRIILCGCGTSYNSAIAVRQLMEELTELPVTLELASDVLDRQCPFFRDDSII
FISQSGETADTLRALEYAKSKGALCIGIVNVVGSAISRATDCGLHINAGAEIGVASTKAY
TCQITSMVLLALALSEDSRSRADRRMDIMRGVVTLPDTMRRALELDQKMLALARTLVDEN
SLLLFGRGYNYATALEGALKVKEVALLHSEGILAGEMKHGPLALVDETLPLVVIATRDSS
YLKQKSVIEQLRARDARCILIVSEDDDSLDKFASNEDMIIKVPEVCDCLQPLINIVPLQL
LSYHLTVLRGHNVDQPRNLAKSVTVE
Download sequence
Identical sequences A4RXZ5
XP_001417840.1.19716 jgi|Ost9901_3|31870|eugene.0500010407 436017.A4RXZ5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]