SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Ost9901_3|89194|ost_14_016_029 from Ostreococcus lucimarinus CCE9901

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Ost9901_3|89194|ost_14_016_029
Domain Number 1 Region: 4-76
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.33e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 2 Region: 101-168
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000104
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 3 Region: 185-250
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000468
Family Eukaryotic type KH-domain (KH-domain type I) 0.0019
Further Details:      
 
Domain Number 4 Region: 271-305
Classification Level Classification E-value
Superfamily WW domain 0.000000000638
Family WW domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Ost9901_3|89194|ost_14_016_029
Sequence length 310
Sequence
MDPSSVTEYVMCPNESAGKVIGHGGEKINSIQTESGAIVKIQNQNEVGPGQPRRITISGA
PERVAHASQLVYAIIGQSSASRAAQAPRGAGGGRDAAGAEIFVPVEPDQFGKIIGRGGET
IRRLQEESGVRMQVDRPNSRVQITGDASGCEVARTLLQEVLDATNEPVGMGTSGAQSTEI
SAQGQEGRIIGKGGENIRSLAAQTGAKLSIIKETGMVRIQGDPRQIEDAVRAVNEFIDAQ
VNPVKYPNAVGGGAGIPSNGAYHPPEDSGGLTPYKPLWETHQSPEGYTYYYNTTTGETTW
EEPEDYDGFS
Download sequence
Identical sequences A4S7U1
XP_001421332.1.19716 jgi|Ost9901_3|89194|ost_14_016_029 436017.A4S7U1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]