SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46445682|ref|YP_007047.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46445682|ref|YP_007047.1|
Domain Number 1 Region: 261-507
Classification Level Classification E-value
Superfamily RNI-like 9.94e-38
Family Cyclin A/CDK2-associated p19, Skp2 0.02
Further Details:      
 
Domain Number 2 Region: 150-230
Classification Level Classification E-value
Superfamily POZ domain 0.000000243
Family BTB/POZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46445682|ref|YP_007047.1|
Sequence length 531
Comment hypothetical protein pc0048 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MTIHNLRFTPKITFSNPATYYYESNNCLKFSERVSLFCITIFQSFLNLFFGYLKKDQLQT
PWRENFWSRKEITIPKFITSRPPSSDISLTRIRSQETINNLEYENEVLLEPSNTLEGIEA
FAIQSSSLSPLPQVFKVRFQNNTFLNITSSQKSLLMEKSPYFRVLWSGNFKETLQNPLVL
TQKEEFTSLLFCLMNANFKVPVEDITSFIQLADYYLLTDVVKNLEEQLIDAYKSEELDLF
NFNEENLAKLRESLNFAHQYRLSALKNYLQPIVASLLLNQTPHLAEFKKILNYFSNEIEK
LNFSENAHLTDAHLLALKNCKNLKALHLQACHNLTDDGLASLTSLTNLQYLNLSCCDKLT
NKGLAHFKSLIALQYLNLSGCAFITDAGLAHLKPLVALQYLNLSGCAFITDAGLAHLKPL
VALQYLNLSGCAFITDAGLAHLTPLVTLKHLDLSWCNSLTNAGLERLASLVALQHLNLSG
CIYLTEAGLTHLTSLTNLQQLNLNHCEHFADVRFKLTHFRTLLANPNLILI
Download sequence
Identical sequences Q6MF77
264201.pc0048 gi|46445682|ref|YP_007047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]