SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46445968|ref|YP_007333.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46445968|ref|YP_007333.1|
Domain Number 1 Region: 316-556
Classification Level Classification E-value
Superfamily RNI-like 1.55e-49
Family 28-residue LRR 0.049
Further Details:      
 
Domain Number 2 Region: 164-238
Classification Level Classification E-value
Superfamily POZ domain 0.0000011
Family BTB/POZ domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|46445968|ref|YP_007333.1|
Sequence length 616
Comment hypothetical protein pc0334 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MHIHNPSFNRQTLIANADTHLYYRSNDHLRFSERINLLCKTIFQNFLNLFFNYINRDQLQ
SQWREIFWGRKEIATTRPESSVSLSSSTQTSVFVLPSSEKARTQETIDNSKDENKPLVNS
LAGIEEIEASTIQPSNPLPFPQEEFKLSFLDKTSLNISSSQLSLLMEKSLYFKSLWSGNF
KETLRDPLTLTQKEFIHLLNCLLDANYKVPLKKICSFIQLADYYQLTEVVKNLEQRLLDA
YKSKKFELFNSSEDSLVKLKELLNFAQQYQLNTLKNYLELTVVSSLLNQASHLTEFEKII
NYFANAIEGLNFSEYAYLTDIHLLALKSWELTDARLAHLAPLVNLRHLNLSGDMSNLTDA
GLAHLTPLVNLQHLNLHWCDKLTDDGLAHLRSLVNLQHLNLHCCNKLTDAGLAHLRPLVN
LQHLNLSKCPKLTDAGLAHLTPLVNLQHLDLSWCPLNFTGAGLAYLAPLIDLQYLNLCCC
NELTDIGLMHLTPLVNLQHLDLSGCDNLTDAGLMHLTSLVNLQHLNLRCCDNLTKTGLMH
LTSLVNLRQLVLSWYSPDLNEAGLAHLIPHFEASQPWDDLYHYRHLLQAKLAYTSFLRRG
QWGLPTLIRKHSMPLN
Download sequence
Identical sequences Q6MEE1
WP_011174884.1.90613 264201.pc0334 gi|46445968|ref|YP_007333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]