SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46445969|ref|YP_007334.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46445969|ref|YP_007334.1|
Domain Number 1 Region: 276-631
Classification Level Classification E-value
Superfamily RNI-like 2.71e-49
Family 28-residue LRR 0.014
Further Details:      
 
Weak hits

Sequence:  gi|46445969|ref|YP_007334.1|
Domain Number - Region: 164-237
Classification Level Classification E-value
Superfamily POZ domain 0.00259
Family BTB/POZ domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46445969|ref|YP_007334.1|
Sequence length 642
Comment hypothetical protein pc0335 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MYIHNPNFHQPTLNANADIHFYYPSNDCLKFSKRINLLCKTIFQSFLNLFFNYINRDQLQ
SQWREIFWGRKEIATTRPESSVSLSSSTQTPVFVLPSSEKARTQETIDNSKDENKPLVNS
LVAIEEIEAPTIQPSNPSPFSQEKFKLSFQDGTSLIIHISQLSLLREKSPYFNCLWSGNF
QETLRESLALTQKEFTKLLNCLDDDFKVPLKKICSFIQLTNYYQLTEVVKNLEKQLLDAY
KSDKFELFNFHEDNLIELKKLLNFAQQYQLNTLKNYLELTVVSALLNQTSHLTEFEKILN
HFSNEIEALNFSKNAHLTDAQLLTLKNCKNLKVLQLQACHNFTDAGLAHLTPLMALQHLN
LSYCKNLTDAGLAHLAPLVVLQHLNLSSCHNLTDAGLAHLTPLVALTHLNLSWCNKLTDA
GLAHLTPLVALTHLDLRECDKLTNRGLAHLALLLTLQYLDLNYCRNLTDAGLAHLSSLVA
LQHLKLCCCVSLTDAGLAHLAPLVALTHLDLSWCFNITDAGLAHLTPLVTLQHLGLSGCR
RLTDVGLAHLTRLVALQHLGLNRCDNLTDAGLAHLTPLINLQHLDLSECRKLTNAGLAHL
TPLVALQRLDLRCCNKLTGARLAHFKFLVAKPHLDLRWYKNS
Download sequence
Identical sequences Q6MEE0
WP_011174885.1.90613 gi|46445969|ref|YP_007334.1| 264201.pc0335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]