SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46446377|ref|YP_007742.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46446377|ref|YP_007742.1|
Domain Number 1 Region: 275-522
Classification Level Classification E-value
Superfamily RNI-like 3.92e-56
Family 28-residue LRR 0.056
Further Details:      
 
Domain Number 2 Region: 503-764
Classification Level Classification E-value
Superfamily RNI-like 3.4e-43
Family Cyclin A/CDK2-associated p19, Skp2 0.054
Further Details:      
 
Domain Number 3 Region: 114-191
Classification Level Classification E-value
Superfamily POZ domain 0.0000000589
Family BTB/POZ domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46446377|ref|YP_007742.1|
Sequence length 765
Comment hypothetical protein pc0743 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MYIHNSRFNSSHFIVNTDSHTYYRSNNRLNFSERINLLCKKIFQSSLNPFFSYINRDQFQ
SQWREIFWGRKEIATNRPGSGLPLPSSSQTLCFVPPSYKLSFQDKTSLSISSSHISLLME
KSLYFKSLWSGNFQETLQDPLDLTQKEFTYLLNCLVDASFKVPVEDLPSFIQLADYYQLA
EVVKNLEERLLDAYKSEEGELFNSTEDSLVKLKEVLNFAHQYHLDALKNYLEFTVVSNLL
NQAPDLTEFEKILNHFLNEIEELNFSKNAHLTDAHLLALKNCENLKVLNLQACHNLTDAG
LAHLTPLAALKHLDLSGCELTDDGLVHLTPLAALQHLDLSHCRNFTDAGLAHLKLLVALQ
HLNLSHCGKLTDAGLAHLKLLVALQHLDLSHCRNFTDAGLAHLKLLVALQHLNLSYCGNL
TDAGLAHLTPLMALQHLDLNGCHNLTDAGLTHLTSLVVLQYLNLSWNYNFTDAGLAHLTP
LMALQHLNLSYCGNFTDAGLAHLTSLAALKHLDLIGCELTDDGLAHLKLLVALQHLNLSY
CGKLTDDGLAHLKLLVALQHLDLSGCDKLTGAGLAHLKFLVALQHLNLSHCGKLTDDGLV
NLTPLAALRHLDLSHCGKLTGAGLAHLKFLVALQHLNLSHCGKLTDAGLVNLSPLMALQH
LDLSHCGNLTDAGLVNLSPLMALQHLDLSHCGNLTDDGLVNLKFLVALQHLDLSHCGNLT
DDGLAHLSPLIALQHLDRSKYNNLTDGSGLAHLTSLVDLQHLDLS
Download sequence
Identical sequences Q6MD82
gi|46446377|ref|YP_007742.1| WP_011175293.1.90613 264201.pc0743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]