SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46446388|ref|YP_007753.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46446388|ref|YP_007753.1|
Domain Number 1 Region: 241-482
Classification Level Classification E-value
Superfamily RNI-like 1.94e-23
Family Cyclin A/CDK2-associated p19, Skp2 0.0058
Further Details:      
 
Domain Number 2 Region: 95-202
Classification Level Classification E-value
Superfamily POZ domain 0.000000589
Family BTB/POZ domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46446388|ref|YP_007753.1|
Sequence length 501
Comment hypothetical protein pc0754 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MQGPDFLSPNLNAYLNLESDRELFQALTKQPLDLIAFFEAGCEDEAWFTKHAGFIQLIIR
WTAKSFYLNQLPIYYAEKLAHIIRSHQHQLKPYLLFQPALFLTFKLVIQGQIRIVNSLLL
GTISPFFKDLFINYYQQLKDRWEIPKISLDTFNWIESYALKESAEELWRCESHELMAIMQ
QAQAWRIQGLVRDCAKLLKKYINQENVVENLIKAHRQYFLDWKVVISEVFNSYGYGLKLL
PCQSETELRIEFLDFKQETLDLFHQLASFITHLTFSEDLSTSPYYGKCVNACPRLMGADL
TGSTVYDNQFDDLPGSLGELNLSVCGWLRPHHIREIGHQFLNLKKLILDGNVHLNYQSWG
ELHRLQTLISLSTRQCHQLTNDDLKSICRNCSRLEEFDVEECRLLTDQGILEIFSSCSHL
SKFNCNRCDLITDKGLLEIGVRAHLLSQLSIERCSKLTDQGLLYFLRLKPNLKELSIKGC
EFSLTCLEEVRREYPFLKLLD
Download sequence
Identical sequences Q6MD71
WP_011175304.1.90613 gi|46446388|ref|YP_007753.1| 264201.pc0754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]