SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46446627|ref|YP_007992.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46446627|ref|YP_007992.1|
Domain Number 1 Region: 229-468
Classification Level Classification E-value
Superfamily RNI-like 8.24e-52
Family 28-residue LRR 0.02
Further Details:      
 
Domain Number 2 Region: 84-159
Classification Level Classification E-value
Superfamily POZ domain 0.00000126
Family BTB/POZ domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46446627|ref|YP_007992.1|
Sequence length 478
Comment hypothetical protein pc0993 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MNISNSGFNSSYPVHTTTPSYYPSQAISDHLEDENTPLANSLDNLEETSASTIPAPALSP
SSEEVQLSFQEGTSLTISHSLLTFLREKSPYFKNLWSGQFQETLQHPLDLTKEDFTLLLN
CLTIPKFVIPLKKIPYSIQLAQYYGLIGLVKHLEGQLINEYNSQRFEPFDYTEESLIEFK
ELLNFAHCCQLNELKEDLELNIANVLLNATSQLAEFERTIKHLSNEIDILHFSNQTYLTD
AHFSALKECKNLKILTFETCQALTDDGLAHLASLTALQHLGLRGCDKVTDAGLAHLTSLR
ALQYLDLSFCRNITDAGLAHLTPLTALQRLLLKKCENLTGAGLAHLTPLKALQYLDLSYW
DNLTDDGLAHLRPLVALQHLDLANCYELTDAGLAHLTPLVALTHLKLIWCHKLTDAGLAH
LRPLVALKHLNLSSCRNLTDAGLAHLIPLTALQYLNLSDCRKLTDTGLASFKASILIQ
Download sequence
Identical sequences Q6MCI2
264201.pc0993 gi|46446627|ref|YP_007992.1| WP_011175543.1.90613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]