SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46446843|ref|YP_008208.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46446843|ref|YP_008208.1|
Domain Number 1 Region: 1-46
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00000000000000647
Family DNA/RNA non-specific endonuclease 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46446843|ref|YP_008208.1|
Sequence length 60
Comment hypothetical protein pc1209, partial [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MTNMCPQSPSFYRGYWSKWERYVRDLTKLQQNVYVITGPLYLSHEGCEGKGYVTYQVNDS
Download sequence
Identical sequences 264201.pc1209 gi|46446843|ref|YP_008208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]