SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46446910|ref|YP_008275.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46446910|ref|YP_008275.1|
Domain Number 1 Region: 403-650
Classification Level Classification E-value
Superfamily RNI-like 1.35e-57
Family 28-residue LRR 0.036
Further Details:      
 
Domain Number 2 Region: 250-469
Classification Level Classification E-value
Superfamily L domain-like 2.11e-32
Family Internalin LRR domain 0.012
Further Details:      
 
Domain Number 3 Region: 117-192
Classification Level Classification E-value
Superfamily POZ domain 0.00000691
Family BTB/POZ domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46446910|ref|YP_008275.1|
Sequence length 667
Comment hypothetical protein pc1276 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MCKTIFQSFLNLFFNYLEKEQLQSQWREISWGRKEITIPKFIASRLASIDKFEDENELLL
NSLANPEGLNALKNTSPKKIKSSITPQSSDLFSSSQEFKLRFQDETSLNISYSQLALLRE
ESPYFKSLWSGNFRETLQNPLALTQTEFTHLLDCLEYSISFVPLEDILSFIQLADYYQLS
EAGKKLEKQLIDAYKSQKLEPFNSTTDSLVELKALLNFAQQYQLNTLKNYLELIVVSSLL
NQASHVTEFEKILKHFSNEIERLNFSKNIFLTDAHLLALKNCKNLKALHLQECDKLTDAG
LAHLASLMALQHLNLNGCWELTDAGLAHLASLMALQHLNLAKCHKITDAGLAHLTSLVAL
QHLDLSCCRNLTDAGLTHLRPLVALTHLNLAKCHKITDAGLAHLTSLVALQHLDLSYCEK
LTDAGLAHLTPLVALQHLDLSYSHHFTNAGLAHLTSLVALQHLNLNSCYKFTDAGLAHLT
SLVALQHLDLSCCRNLTDAGLAHLAPLVALQHLDLSYSHHFTNAGLAHLTSLVALQHLDL
SCCRNLTDAGLAHLTSLVALQHLDLSSCKKLTDAGLEHLTPLVALQHLDLSSCKKLTDAG
LAHLAPLVALQHLDLSSCKKLTDAGLAHLAPLVALQHLNLNWCDKLTDAGVAHFKSSVAP
LHLKIIY
Download sequence
Identical sequences Q6MBP9
264201.pc1276 gi|46446910|ref|YP_008275.1| WP_011175825.1.90613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]