SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46447283|ref|YP_008648.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46447283|ref|YP_008648.1|
Domain Number 1 Region: 264-506
Classification Level Classification E-value
Superfamily RNI-like 1.02e-36
Family Cyclin A/CDK2-associated p19, Skp2 0.012
Further Details:      
 
Domain Number 2 Region: 146-223
Classification Level Classification E-value
Superfamily POZ domain 0.0000000416
Family BTB/POZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|46447283|ref|YP_008648.1|
Sequence length 521
Comment hypothetical protein pc1649 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MVILITYYNNPISKHNSLTTNTNTCSSYKSNNYLKFSERINLLCTTIFQCFLNLFFNCIP
RDQLQSQWKEVFWGRKVTVNRKFMEHRLSSDPTSLSKIENKLLRNSSVTLEEIDESTIPS
SNLLPLSQEFKLSFQNNTFLTITSSQKSLLMEKSPYFQGLWSGNFKETFQHPLALTQKEF
TRLINCLLDANFKVPVEDITSFIQLADYYQLTDVVKNLEKQLLDAYKSDKFELFNSSEDR
LVELKEFLDFAERFQLNILKNYLQLTVVNLLLKQTPHLKEFEKILNYFSNEIEGLNFSEN
AYLTDAHLLALKNCKNLKVLQLQSCHHLTDTGLACLPSLTNLQYLNLNGCKKLTDAGLAH
LTPLVNLQYLDLGFCDKLTSKGLGHFKSLIALQHLNLSGCKFIRDNGLAHLTPLVALQYL
NLSQCTFLTDAGLAHLVPLVALKHLDLSWCNSLTNAGLAHLVHLVALQYLNLSGCIYLSE
AGLAHLAPLTSLQHLNLEDCEHFTNARFRLAHFKALLAATN
Download sequence
Identical sequences Q6MAM6
264201.pc1649 gi|46447283|ref|YP_008648.1| WP_011176195.1.90613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]