SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46447448|ref|YP_008813.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|46447448|ref|YP_008813.1|
Domain Number - Region: 34-125
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.000818
Family DBL homology domain (DH-domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46447448|ref|YP_008813.1|
Sequence length 217
Comment hypothetical protein pc1814 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
METEKPVIILVSTHSSFHEKISGDLKMNAFVSTIRNHVKGKITVLLSDRAHINTMSLRFQ
NDLQKAQEECLIKAHALRNRYQSYFENCNVVYGHSYISQNKNFASFLKVIESLAENDSTF
HELLLKDAESAYSNTFIHLFPDKNLFIKNTREDILTQCASSLVLIDKGYRYQFYPGSSYE
SLDYLNRIFISQEKQLSWIRVFLTIEKKTILHNIMQN
Download sequence
Identical sequences Q6MA61
gi|46447448|ref|YP_008813.1| 264201.pc1814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]