SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46447582|ref|YP_008947.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46447582|ref|YP_008947.1|
Domain Number 1 Region: 14-71
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.000000765
Family DNA/RNA non-specific endonuclease 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46447582|ref|YP_008947.1|
Sequence length 83
Comment hypothetical protein pc1948 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MYKIISKIIFFQATLIPHSSFVIHRPGYSLHYDARHLKPAWVYEHLAAEHLQGNAERSLA
FKEDEKNSSTFKSHFSRLQRKWI
Download sequence
Identical sequences Q6M9S7
gi|46447582|ref|YP_008947.1| 264201.pc1948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]