SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|46447588|ref|YP_008953.1| from Candidatus Protochlamydia amoebophila UWE25

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|46447588|ref|YP_008953.1|
Domain Number 1 Region: 340-582
Classification Level Classification E-value
Superfamily RNI-like 1.33e-58
Family 28-residue LRR 0.086
Further Details:      
 
Domain Number 2 Region: 190-390
Classification Level Classification E-value
Superfamily RNI-like 1.88e-30
Family Cyclin A/CDK2-associated p19, Skp2 0.012
Further Details:      
 
Domain Number 3 Region: 529-694
Classification Level Classification E-value
Superfamily L domain-like 8.5e-18
Family Internalin LRR domain 0.032
Further Details:      
 
Domain Number 4 Region: 53-128
Classification Level Classification E-value
Superfamily POZ domain 0.0000022
Family BTB/POZ domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|46447588|ref|YP_008953.1|
Sequence length 704
Comment hypothetical protein pc1954 [Candidatus Protochlamydia amoebophila UWE25]
Sequence
MDENNPLDNPLPNLEETSASTIPAPALSPSSEKIQLSFQEGTSLTITHSQLALLREKSHY
FKNLWSGQFQETLQHPLDLTQKDFTLLFNCLLDANFKVPVEEITSAIQLADYYELTEVVK
NLEKQLIDGYKLRRFEPFNSTEKSLIELKELLNFARQCRLNMLKNYLEFTVVSELLNQAV
QLAEFERIIIPFSKEIEALNFSNNDYLTDAHLLTLRNCENLKVLHLNACQAITDDGLAHL
TPLTGLQHLDIRVCEYLTDDGLAYLTSLTGLQHLNLSGCYHLTDTGLAHLTPLTGLQHLD
LRICEYLTATGLAHLKPLKALQHLDLSYCKNLTNVGLSHLAPLTALQHLDLSYCWQLADA
GLVYLTPLTGLQHLDLSGYHKLTDAGLAHLTPLTALQCLDLSYCENLTDVGLAHLMPLKA
LQHLNLRNCRNLTDDGLAHLAPLTALQHLDLSYCWQLTDAGLAHLTPLTGLQRLDLSYCE
NLTDVGLAHLIPLKALQHLNLRNCRNLTDDGLVHLAPLTALQHLDLSDCNNLTDAGLAHL
TPLTALQHLDLKYCINLTGAGLAHLAFLTGLQYLDLSWCKNLIDAGLVHLKLLTALQYLG
LSYCENLTDDGLAHLRSLTALQHLALIHYKNLTDAGLVHLRSLTSLQHLDLRYCQNLTGD
GLAHLRTLTALQYLALTQYKNLTDDGLARFKTLASSTNLRIKFH
Download sequence
Identical sequences Q6M9S1
gi|46447588|ref|YP_008953.1| 264201.pc1954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]