SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10001934m|PACid:20909456 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10001934m|PACid:20909456
Domain Number 1 Region: 32-213
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.96e-69
Family Inorganic pyrophosphatase 0.00000475
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10001934m|PACid:20909456
Sequence length 217
Sequence
MSGEEEVKTNQSQKKLQQPTPRLNERILSSLSKRSVAAHPWHDLEIGPGAPVIFNVVIEI
SKGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPMDVLVIMQEPVLPG
CFLRARAIGLMPMIDQGERDDKIIAVCVDDPEYKHYTNINELPPHRLTEIRRFFEDYKKN
ENKEVAVNDFLQPGPAIEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences R0GXC3
XP_006288631.1.15642 Carubv10001934m|PACid:20909456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]