SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10014274m|PACid:20899299 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10014274m|PACid:20899299
Domain Number 1 Region: 66-296
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-84
Family Inorganic pyrophosphatase 0.000000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10014274m|PACid:20899299
Sequence length 300
Sequence
MAATRVITAATAVTQTTSCFLAKRAFALPVKKSCGGFGALCFSRRALVLKSKRPFSCSAI
YNPQVKVQEEGPPDSLDYRVFFLDGSGKKVSPWHDIPLTLGDGVFNFIVEIPKESKAKME
VATDEDFTPIKQDTKKSKLRYYPYNINWNYGLLPQTWEDPSHANSEVEGCFGDNDPVDVV
EIGETQRKIGDVLKIKPLAALAMIDEGELDWKIVAISLDDPKAHLVNDVEDVEKHFPGTL
TAIRDWFRDYKIPDGKPANRFGLGDKPANKEYALKIIHETNESWTKLVKRSVDAGDLSLF
Download sequence
Identical sequences R0HN24
Carubv10014274m|PACid:20899299 XP_006298216.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]