SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10018002m|PACid:20888539 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10018002m|PACid:20888539
Domain Number 1 Region: 31-211
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.76e-68
Family Inorganic pyrophosphatase 0.00000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10018002m|PACid:20888539
Sequence length 216
Sequence
MAPPIEIAAKSYVEKHVALPTLNERILSSMSHRSVAAHPWHDLEIGPEAPIIFNCVVEIG
KGSKVKYELDKTTGLIKVDRILYSSVVYPHNYGFIPRTLCEDSDPIDVLVIMQEPVIPGC
FLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDISELPPHRMAEIRRFFEDYKKNE
NKEVAVNDFLPATAAYDAVQHSMDLYADYVVENLRR
Download sequence
Identical sequences R0HHQ1
Carubv10018002m|PACid:20888539 XP_006291827.1.15642 XP_010515860.1.75697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]