SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10020891m|PACid:20905754 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10020891m|PACid:20905754
Domain Number 1 Region: 74-230
Classification Level Classification E-value
Superfamily IpsF-like 1.7e-58
Family IpsF-like 0.00000946
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10020891m|PACid:20905754
Sequence length 231
Sequence
MAMATSSSTQLPLSSSLFHPQITKTPLLLPVTKLGLRITKKSLSLSCRPSISATSAVGVN
DEPATSKKSTKTLPFRVGHGFDLHRLEPGYPLIIGGIDIPHDRGCEAHSDGDVLLHCVVD
AILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMDEAGYEIGNLDATLILQRPKIS
PHKETIRTNLSKLLGADPSVVNLKAKTHEKVDSLGENRSIAAHTVILLMKK
Download sequence
Identical sequences R0IFV6
XP_006302770.1.15642 Carubv10020891m|PACid:20905754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]