SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10025469m|PACid:20903964 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10025469m|PACid:20903964
Domain Number 1 Region: 25-125
Classification Level Classification E-value
Superfamily Cupredoxins 3.1e-36
Family Plastocyanin/azurin-like 0.0000692
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10025469m|PACid:20903964
Sequence length 194
Sequence
MASIKRVFFTSLLILVALCGVAIGGTVHKVGDSNGWTMMGVDYEAWASSRTFQVGDSLVF
NYNKDFHDVTEVTHNDFNLCDPSKPITRYETGSDTVTLTKPGLQHFICGFPSHCDLGQKL
QIHVLPASLGPVAAPVPKPVRSPSSSSSPSPLANSPATSAPQYQMGPSPAPLSAASKSSA
WIGLCFLPLLSLFI
Download sequence
Identical sequences R0G1Q4
Carubv10025469m|PACid:20903964 XP_006296298.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]