SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10026867m|PACid:20911364 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10026867m|PACid:20911364
Domain Number 1 Region: 66-296
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.02e-85
Family Inorganic pyrophosphatase 0.000000421
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10026867m|PACid:20911364
Sequence length 300
Sequence
MAATLLTTAAAVASSQTTSGLLTKRPVFLPARTVCRFNGLCFNKRSLVVKSKRPFSCNAI
YNPQVQTIQEGQSESLDYRVFFQDGSGKKVSPWHDIPLHLGDGVFHFIVEIPKESRAKME
VATDEAFTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPTQANSEVEGAFGDNDPVDVV
EIGETRRKTGEVLKVKPLAALAMIDEGELDWKIVAISLDDPKAHLVNDVDDVEKHFPGTL
TAIRDWFRDYKIPDGKPANKFGLGNKPANKDYALKIIHETNESWAKLVKRSVSPGELSLF
Download sequence
Identical sequences R0GRE7
Carubv10026867m|PACid:20911364 XP_006280875.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]