SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10005066m|PACid:20895653 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10005066m|PACid:20895653
Domain Number 1 Region: 47-260
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.13e-20
Family BAR domain 0.036
Further Details:      
 
Domain Number 2 Region: 306-363
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000131
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Carubv10005066m|PACid:20895653
Sequence length 373
Sequence
METIRKQASKLREQVARQQQAVLRQFGGGGYGGSDTVITDEEELHRHQKLDKLYISTRSA
KRFQRDIVRGVEGYIITGSKQVEIGTKLCEDSRKYGSENTCTNGNTLTRASLSFANARAQ
MEKERGNLLKTFGTQVAEPLRAMVMGAPLEDARHLAQRYDRMRQEAEAQTIEVSRRQAKV
RENPGNPELVMKLESAEAKLQDLNSNMTILGREAASAMAGVEDQQQTQTLQRLITLVEAE
RSYHQRILEIIERLEGEMRFEQQRIEAPQTPQVENITSSPPPSHQEANNGVNTSQVHNGT
SDAMGYFLGEVMFPYQADSEYELSLSVGDYVVIREVASSGWAEGECKGKAGWFPYDYIER
RDRVLATKVIEVF
Download sequence
Identical sequences R0F2L7
XP_006282653.1.15642 Carubv10005066m|PACid:20895653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]