SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10005154m|PACid:20893906 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10005154m|PACid:20893906
Domain Number 1 Region: 48-258
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.19e-25
Family BAR domain 0.037
Further Details:      
 
Domain Number 2 Region: 280-344
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000144
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10005154m|PACid:20893906
Sequence length 351
Sequence
MDAFRRQASKLRDQVAKQQLAVIKQFSGTGYESSDVMVIDELEMQRHHQLDKLYRSTRSA
KEFQREIVKAAETFTTIGLRHIEAGTKLSEDCCRYGNENSQNIDENILAKAAAIYGDARK
HVDKEQEDFNKLLASQVLDPLRAMVAGSPLEDARHLAQRYSRMRQEAETHATEVSRRQAR
VREAPIPENVAKLQLAEAKMQELKANMAVLGKEATAALAAVESQQHRLTFQRLVAMVEGE
KNYHLRIAAILSDIEAEMVTEKQHKESAPPAIPTENGSEKTSYFLAEVVHPFSAASEKEL
DLSKGDYVVVRKVSQTGWAEGECKGKAGWFPMAYIEKRQRLPTNNFAAEVY
Download sequence
Identical sequences R0GX81
XP_006284032.1.15642 Carubv10005154m|PACid:20893906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]