SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10008422m|PACid:20888946 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10008422m|PACid:20888946
Domain Number 1 Region: 392-680
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-74
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 280-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000652
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10008422m|PACid:20888946
Sequence length 734
Sequence
MKKVPSLFLLVAIFFVAYTQLAKGQPQPRHDCKSRCGNVTIEYPFGISTGCYYPGDDVFN
ITCAEDKPNVIENIEVRNFYHSGQLRGMLPRSTVCYDGVRNDEFSSLWFQLDNLSLSTKN
KFTLVGCNAWALLSTFGLQNYSTGCLSLCDSSSVPNNKCNGVGCCRTDVSVPLDSNRLEM
QPARFENMTSVKHFNPCVYAFFVEDGMFNFSSTEDLENLRNVRQFPVVLDWSIGNHTCEQ
VVGRDICGGNSTCFDSTRGKGYNCKCLQGFEGNPYLSNGCQDINECTTSSSIHKHNCTDP
KTCRNRDGGYYCKCQSGYGLDTTTMSCKRKDFGWAMILLGTTIVFLVILLGASLIKQRLR
HRKDIELRQQFFEQNGGGMLIQRLSGAGPSNVDVKIFTEQGMQESTNDYDESRILGQGGQ
GTVYKGILPDNSVVAIKKARLGDRSQVEQFINEVVVLSQINHRNVVKLLGCCLETEVPLL
VYEFITSGTLFDHLHGSTFDSSLSWEHRLRIAVEVAGTLAYLHSSASIPIIHRDVKTANI
LLDENLTAKVADFGASRLIPMDQEQLTTMVQGTLGYLDPEYYNTGLLNEKSDVYSFGVVL
MELLSSQKALCFERLETSKHIVSYFVAAMKENRLHEIIDSQVMNEYNQREIQEASRIALE
CTRLMGEERPRMKEVAAKLEALRVKTTKHKWSDQYPEENDHLLGVQILSAQGDTSSIGYD
SIKNVAILDIEAGR
Download sequence
Identical sequences R0GLH3
XP_006303914.1.15642 Carubv10008422m|PACid:20888946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]