SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10010288m|PACid:20889917 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10010288m|PACid:20889917
Domain Number 1 Region: 28-208
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 7.2e-71
Family Inorganic pyrophosphatase 0.00000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10010288m|PACid:20889917
Sequence length 212
Sequence
MSEEANDDQKLQRPAPRLNERILSSLSRRSVAAHPWHDLEIGPGAPQIFNVVVEITKGSK
VKYELDKKTGLIKVDRILYSSVVYPHNYGFVPRTLCEDNDPIDVLVIMQEPVLPGCFLRA
RAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLSEIRRFFEDYKKNENKEV
AVNDFLPSETAVEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences R0IN48
Carubv10010288m|PACid:20889917 XP_006305610.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]