SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10018800m|PACid:20886811 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10018800m|PACid:20886811
Domain Number 1 Region: 188-254
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.9e-19
Family DNA-binding domain from rap30 0.0035
Further Details:      
 
Domain Number 2 Region: 15-125
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0000000183
Family Rap30/74 interaction domains 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10018800m|PACid:20886811
Sequence length 258
Sequence
MEDVKVEFKVKKIENEALETGLAERSMLLMKAPSLVARSLQSLPIPDDPYRPDAKIILSV
DPIAHEDEETKFVMELARAESGNMPRRYTLDMSKDFVPMSVFCESSDGKMSVEGRIKHKF
DMRPYNENIESYGRLCRERTNKYMGKNRQIQVIDNARGMHMRPMPGMIIPTAAPEKKKLT
NRTSEMKRTRRDRREMEEVMFNLFERQSNWTLRQLIQETDQPEQFLKDLLRDLCIYNNKG
SNQGTYELKPEYKKAPQD
Download sequence
Identical sequences R0FRY1
XP_006292564.1.15642 Carubv10018800m|PACid:20886811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]