SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10019152m|PACid:20885997 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10019152m|PACid:20885997
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily SAP domain 3.82e-16
Family SAP domain 0.0045
Further Details:      
 
Domain Number 2 Region: 106-169
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000221
Family PHD domain 0.000048
Further Details:      
 
Weak hits

Sequence:  Carubv10019152m|PACid:20885997
Domain Number - Region: 374-408
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0288
Family PHD domain 0.03
Further Details:      
 
Domain Number - Region: 390-439
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 0.0471
Family Zn-finger domain of Sec23/24 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10019152m|PACid:20885997
Sequence length 872
Sequence
MDLVASCKEKLAYFRIKELKDVLTQLGLSKQGKKQDLVQRILTILSDEPAGRLWSKRDAM
AREKVAKLVEDAYRKMQASGASELASKGKVSSDISNVKVKGELEDPFQPDNKVRCICGSS
LETESMIQCEDPRCHIWEHVGCVIIPEKPMEVNPPLPESFYCEICRLTRADPFWVTMAHP
LYPVRLTTTTAPTDGSNPMQSVDRTFQITRADKDLLVKHEYDIQAWCMLLNDKVLFRMQW
PQYADLQVNGVPVRAINRPASQLLGANGRDDGPMITPCVRDGINKISLSGCDSRSFCLGV
RLVKRRTLQQVLNMIPDEDKGEPFETALARVRRCIGGATGNDDADSDSDIEVVADFFGVN
LRCPMSGSRMKVAGRFKLCVHMGCFDLEVFVELNQRSRKWQCPICLKNYSLEHIIVDPYF
SRITSKMRHCDAELTEIEIKPDGSWRVKFKSDSDRRELGELSKWHTPDGSLIPTIDEIKP
KMIMLTSVKQEGFSDDLTPLKLGIRKNRNGIWEVSKSNINGLSSSNKQEKVEYQEQNVIP
MSSSATGSGRDGDDPSVNQDAVGTFDFGNNGLELDSLSMNADPSYNFSDRNHQPAVESNN
EVIVLSDSDDENDVVITGGPAFNENQPDGEANFPLHPPGINSYSEDPHTMAGSSSGLGLF
TDIDDDYDMRLWQFSSEPQGGPGFQLFASDAEVSEDLVGLKPGLPNSAPAISSGYTIAPE
QSIPSVPIFPELGGEREADANGGLVDNPLATSEEDPSLQIFLPTRPDTSPQSDLRNQAEV
SNGTPSDDWISLRLGDHGETVGVNRVNENNPVSTSEGVLDTLSETASLLLGMSDSSKQEK
ASRQRSDSPFSFPRQKRSVRPRLYLSINSDSE
Download sequence
Identical sequences R0HKN6
XP_006292887.1.15642 Carubv10019152m|PACid:20885997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]