SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Carubv10025863m|PACid:20913070 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10025863m|PACid:20913070
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily SAP domain 6.56e-18
Family SAP domain 0.0042
Further Details:      
 
Domain Number 2 Region: 105-169
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000221
Family PHD domain 0.0000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Carubv10025863m|PACid:20913070
Sequence length 873
Sequence
MDLEASCKDKLSYFRIKELKDVLTKLGLSKQGKKQELVDRILTLLSDEQAARLWSKKNTV
PREEVAKLVDDTYRKMQVSGASDLASKGQVSSDTNILKVKGEPEDPFQPEMKVRCVCGNS
LETDSMIQCEDPRCHVWQHVGCVIVPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP
LSPVRLTATTIPSDATNTMQSVERTFQITRADKDLLAKQEYDVQAWCMLLNDKVIFRMQW
PQYADLQVNGLPVRAINRPGSQLLGVNGRDDGPIITQCIRDGVNRISLSGGDVRIFCFGV
RLVKRRTLQQVLNLIPEETKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF
NRITSKMKHCDEEVTEIEVKPDGSWRVKSKRESERRELGELSQWHAPDGNLCPSADEVKR
KMEMLPVKQEGVSDGPAPLKLGIRKNRNGIWEVSKPNANGLSSSNRHDKVGYQEKNIIPM
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGDGMNNEV
IVLSDSDEENDLVITPGPAYSGCRTDGGLNFPLNPSGIINSYNDDPHSIAGASSRLGLFN
DDDEFDTPLWSFPSETPEAPGFQLFRSDTDVSEGLVGLHHHGPLSCAPEINGGYPMAPET
SMASVPVVPGSAGRSETNDGLVDNPLAFGRDDPSLQIFLPTKPGASAQSGLKNQADMSNG
IRSEDWISLRLGDSVTGNHGEPATVNGINSSQQMSTREGSLETTTVTASLLLGMNDSRQD
KAKKQRSDNPFSFPRQKRSVRPRMYLSIDSDSE
Download sequence
Identical sequences R0G8L6
XP_006279991.1.15642 XP_006279992.1.15642 Carubv10025862m|PACid:20913069 Carubv10025863m|PACid:20913070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]