SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Carubv10027035m|PACid:20911365 from Capsella rubella v183

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Carubv10027035m|PACid:20911365
Domain Number 1 Region: 66-237
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.13e-63
Family Inorganic pyrophosphatase 0.0000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Carubv10027035m|PACid:20911365
Sequence length 238
Sequence
MAATLLTTAAAVASSQTTSGLLTKRPVFLPARTVCRFNGLCFNKRSLVVKSKRPFSCNAI
YNPQVQTIQEGQSESLDYRVFFQDGSGKKVSPWHDIPLHLGDGVFHFIVEIPKESRAKME
VATDEAFTPIKQDTKKGKLRYYPYNINWNYGLLPQTWEDPTQANSEVEGAFGDNDPVDVV
EIGETRRKTGEVLKVKPLAALAMIDEGELDWKIVAISLDDPKAHLVNDVDDVEKHFPV
Download sequence
Identical sequences R0GAY3
Carubv10027035m|PACid:20911365 XP_006280876.1.15642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]