SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|48477550|ref|YP_023256.1| from Picrophilus torridus DSM 9790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|48477550|ref|YP_023256.1|
Domain Number 1 Region: 37-204
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.28e-22
Family GHMP Kinase, N-terminal domain 0.003
Further Details:      
 
Weak hits

Sequence:  gi|48477550|ref|YP_023256.1|
Domain Number - Region: 224-320
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.000158
Family Homoserine kinase 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|48477550|ref|YP_023256.1|
Sequence length 349
Comment diphosphomevalonate decarboxylase [Picrophilus torridus DSM 9790]
Sequence
MNDLNVYGEKIRNMLLELGIYNKSDDYSPDIKYNKTFHANGYPITGLYKFLGYYDRDNNI
ANFPSISFTTNFSSCDVTCRVLRSGNDRIIFNGKNNEKYYKRAEKALSFLRKKYRIDAAF
EFNIRINRRYRDAKGLGESAAVASATARAVAAAVFGMDAAKDRGFVSYLARHVSGSGTRS
AAGNLSMWLSYPGIDDLSSIGFEIRKDDLFHFYAIPMRSRIETLNAHDYASSSIFYNAWV
KSKFFDIIDIIENKFNTRMMLEYSMKDMYRLQALLISSGYIIYEKHYLDIIRKLRSSLNN
YKNVYFTSDTGTSIVVMSTSMNELSRFVNDLDLDGISGNFPEKIIIEEL
Download sequence
Identical sequences Q6L1T9
gi|48477550|ref|YP_023256.1| 263820.PTO0478 WP_011177279.1.10384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]