SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|48478407|ref|YP_024113.1| from Picrophilus torridus DSM 9790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|48478407|ref|YP_024113.1|
Domain Number 1 Region: 74-162
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.39e-22
Family Imidazole glycerol phosphate dehydratase 0.00051
Further Details:      
 
Domain Number 2 Region: 2-71
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.0000000000000019
Family Imidazole glycerol phosphate dehydratase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|48478407|ref|YP_024113.1|
Sequence length 174
Comment imidazoleglycerol-phosphate dehydratase [Picrophilus torridus DSM 9790]
Sequence
MIRNTRETEIYVELYKDGGINTGDPVLDHMVKTMFFYANIPVTVNAKFDLRHHLWEDLGI
TIGLEINRVKKDNIKRYGYSIIPMDDALIICSIDFSRSYLNMHVDFKDEEGFEISLIHEF
LNALSRTSNITMHFIKMSGENAHHISECMFKALGFSLRSALEASDRIESTKGSI
Download sequence
Identical sequences Q6KZD2
gi|48478407|ref|YP_024113.1| WP_011178136.1.10384 263820.PTO1335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]