SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|48478424|ref|YP_024130.1| from Picrophilus torridus DSM 9790

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|48478424|ref|YP_024130.1|
Domain Number 1 Region: 4-165
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.51e-26
Family GHMP Kinase, N-terminal domain 0.0025
Further Details:      
 
Domain Number 2 Region: 184-325
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.4e-21
Family Mevalonate kinase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|48478424|ref|YP_024130.1|
Sequence length 329
Comment mevalonate kinase [Picrophilus torridus DSM 9790]
Sequence
MNRIYIYSPLRVSFAGGGTDISPFPEKYGGAVLNVTIDRGILIKYINDEKDLEIASRDFL
RSSITGSGGNIAEKKLLEIFNKSGINYGKIMINGDVPPGSGLGSSSALMNSITMLKYEIL
NKELNKYELAEESYNIESNHLGIILGRQDPYAVSLGGFKFMEFTDRGITCEKFAKNSFID
ELEKSMFLVYTGKTRASSDALREQAEKSKKNDRNTISKLLSLKDISYSIRDSIKSQDFDR
FSQLINTGWEIKKTLGSNVSNERIDNIIARARSLGATAARLLGGGSQGFVLIVSKPENLD
YIEKGMTKHSKFVIRISFDYSGTRRISPF
Download sequence
Identical sequences Q6KZB5
263820.PTO1352 gi|48478424|ref|YP_024130.1| WP_011178153.1.10384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]