SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_00087 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_00087
Domain Number 1 Region: 1111-1269,1296-1313
Classification Level Classification E-value
Superfamily Sec7 domain 1.06e-22
Family Sec7 domain 0.00085
Further Details:      
 
Weak hits

Sequence:  PGTT_00087
Domain Number - Region: 1001-1045
Classification Level Classification E-value
Superfamily PH domain-like 0.000246
Family Pleckstrin-homology domain (PH domain) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_00087
Sequence length 1746
Comment | PGTG_00087 | Puccinia graminis f. sp. tritici hypothetical protein (1747 aa)
Sequence
MSNSPAESTTTASSRTRTPSPTNSFKSSTTTPTTPKQQQPPPIPIPHLLLDRSRLKPVPR
QPKPAPIQTPPAFTIPTLRSKLRSTTNPSPHSNNPSQHKPASNRSVSNQSHNNNTSTTPQ
KTSTETQADQPAAEPQPAEPAAAEPQPEPPAESLPEPQAAQSQLEPTVESQPQPPAESTP
EAQPQPPAEPQAEPPKAEDAQPDPPAETQPGLSPTVDSQQADISLPSPSEDSPDQPQAHK
PSPTEPQPMPDHQQDHHQLTNSLPHSENNPDQIQPWQHQFNRILDSDHSSLERANSAAAR
LNSLAKLNGLKIPDLPDPPLHPSSDTDNSLPPFLMAKHIEETKKKAGLISPTLPIPQYPL
PLPVSLGFSVGPNGRGVPRLSALQRKALEKMANQQDSQDLSTATTSLTRSHTTTGTESPK
RLPNPIHSPSTDESHQRQQARSNLIRKLSSRGPNTRLKLSPPLVIPSPADLQADPPSIPN
PQLSCSSQPIHPESAFDHPEPLPELITTPTLDTIDHQAQEIIPSVDHLALNTTTIDSVTV
DLSRTQTPLLEENTMVLNLPPVVTDHSPAVALRYSLNSLDSQTDPKHAIRTAPTNSHNPT
SGSETIIGESKPTVAAQSYPSSSPSHSHPVPESSWLDFSETNSKSFISDSPDLNTEPISE
TTLAPTPDPVASSPSVRSSIVSRLKARASLSSRIDRSTATGRSPSPGQPQSRQSSIDRGS
EVPAERRRSTIHGNHRVSRPSNSSTVQRVRPTANETSQDRARQSYTTLASRVGSPSPSHH
TDRPLRPTRAPPITQAHNVVGGRSAISRKSSTDLGPSQFPPTPHLVRTHMPVASAVDLAR
YNDQKLAPFPALLDSSPPGSPERARSPPRSNLKSSKSQGHSILSSASNFFRSPSRSQDEN
TSRAANQMVSSPPATVMASPPSYPVRMSRSDEEQEEVVEPARWQSMGDAAGKMNAAAEVS
RSATIESNTSSTASMISSQRREQILARLSPFLRPSHPTASPDHRLNDPPRKLLWHQPVLQ
VVNATSVKDRYLFLFNDILVITKPIIEFEDCKGESVPKLPITLKHSFLTKSVVEIKNLRC
VCTNQARRSSTLQDKHPIQSVNDEMSTPEHWFQQAFQEDPSRAIQSHLQSIHLEPTDSEI
AKLLIATTDLDRRQLGQFLTSPDRTGILRSYLEQMNLAYMRIEDSLRSVLLSLRLPADPP
AIERFLEEFGVVWTTSNPKVGLTPALVTRWTTTMIVLSEHLHDGLTDSMRYVAGFIGFPN
DIIKTEVGFVESMVQAEEAFKAQGKPSSSIAAEKLETMLKKSFQSIRRDRLVQARASIED
TEKIKIEVEEEGDSRGSKLPSHIIYQIPSELVTIRIPEADPQFGIKLFGSGLSFEPSFLS
FSQSSSASFRIKGKALGVRQVSMIKIGRRAAAYDGLPLDLTVSVERAFMKHTVQVGFLNH
MMAKRKYLFSFLGPQPKTDFLDLVDDAQAAAKHHQPFPGQNNGPQAVAKTVALQVLIDSL
ILNEDLVPMNVNPYASTTVGLKVTHHNKSKKKELEEEKKPASSSTSNHQSNGNGKIRSNS
LSETYIHTLGSSEKELHQAIIERRNQAQELHIRKRQQKLLKESLVSNLSGGRVNLNPYSC
SNKDAPVGLADENQNIVALKRFIFVGSELIHLCQQNSLVPLVLGFLSMGMVDKNRLITSN
PSAHAGQNHHHPHHHQANHFAKNGSRHLANPNAVPSGDLVSDGHSNPNGNGNGYHYQQHQ
HDYHVI
Download sequence
Identical sequences E3JQ48
XP_003307137.1.73186 PGTT_00087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]