SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_00760 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_00760
Domain Number 1 Region: 16-119
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000043
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PGTT_00760
Sequence length 359
Comment | PGTG_00760 | Puccinia graminis f. sp. tritici predicted protein (360 aa)
Sequence
MASSPTELISRSPSTLLGHPILEGWMLKKKRKKMQGFARRYFYLSQEPAVLSYSFSPNSR
IRDSVLIKLASISISRKSRSIHIDSGGSLVMHIKTLSDPDFLRWTQTLQSLVTNGKLKEC
QRKPRQAPRDTSKALPRYSEFNRSDAGPSVRPVELSNLYHSVARMQAPLSMLQEVQNDLR
ELLFPPQSEPLSAPQPSTPGQPRSPPTMSQPAYNPTTSPKLQYSTPKGKKQHLFKHYSHN
HVTSSVDAHKVYQTITQAVTQLKTEHLNLIDLINIHRTSMISDQPSKLSQTNPRTSPSVH
ITRNPRQSTSSYSHGASASDYVSSSSTVDSQLSSRRRSSTVTKASQRDRVGDGGKPRFE
Download sequence
Identical sequences E3JTU7
PGTT_00760 XP_003319848.1.73186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]