SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_00959 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_00959
Domain Number 1 Region: 18-153
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000059
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_00959
Sequence length 524
Comment | PGTG_00959 | Puccinia graminis f. sp. tritici predicted protein (525 aa)
Sequence
MPSSSSFTASEKAIIKHVLPSDHNKILAAGLCRIYYAYPDPNKCSHNQSQPAPDNLWSYT
GLSGALVFGRPSSGIAGSFWFKLIDISGTRGTIWEHEVYEDGPGRPGHGHFGYHQERTFW
HTFQGDDCMIAFVFVNEDEASAIHKKVINRSKHISKSAAKVKPVEAPVSAPSPVLAPSGK
KKGGIDKSMISAPTDFKRVAHMGYDSNAGFTAENVDPSWAQLLTNLTNMGFSKDEINNSE
SFIKDYVNQAGGIDQVLSSHNNTSASPPTRVPPANPVTSKRVKPPAPPAPTRRTGTSNEN
HNPATPAPMTKSPAAPSRAPPASAAPSRPPPTMPVTPAPSAPVSNPPAPPTAPPPPAPVK
SAPPPPSAPPPPAMAPPPPPAPPPPPPPPSSHAPPPPPPNAPPPPAPPAPPPPPSNAPPP
PPVPSSSISPVSDGSRANLLSSIQGKGIHVLKKTPQGASTHSTGPTNPLSQSTRSAGSDD
AHDGGGASGGGGNLAASLAAALNKRKGTMGEDSEEEAESDDEWD
Download sequence
Identical sequences PGTT_00959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]