SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_01693 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_01693
Domain Number 1 Region: 296-419
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000678
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Weak hits

Sequence:  PGTT_01693
Domain Number - Region: 27-266
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00262
Family FCH domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_01693
Sequence length 432
Comment | PGTG_01693 | Puccinia graminis f. sp. tritici hypothetical protein similar to cytoplasm protein (433 aa)
Sequence
MTKKHTSTIKNGSGCAEHADQPEHKEIDILVDRFLEYKSITKGFIAYYEGLAKLETSTAA
ELQKIGGHLPVPLREGNQFLAEGAGGWQTILFNTRERTRAISDHHTAFAQSITQSTLHDL
NKIKADVKELIAELGAKPTQLATEVGKSRAESTEVITHLSKSIAQSKTNPMALVAHDDPV
LLHRQVEEQVKQQMNLENSLTRMIIEYQKKGLELEKRVNIDIQAVVKDFESARLNAEKSI
SNEWQTIHAGVTGLNPELEWTEFAQRSGHLVPEDIEMRDLEKITFPGHNEELTSPINVGL
LERKKRFTRNYKEGYYVLTPSGYLHEFKTSDPTKHSEPEMSIFLPNCTLGAPAPPEAKTF
KWHIEGARRTSGGHNTGSLNKMKKSLHIGSKEVAFSFKSRTHAEMMHWWELMQKVAQHSG
KPSSISPSIHDV
Download sequence
Identical sequences PGTT_01693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]