SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PGTT_02892 from Puccinia graminis f. sp. tritici CRL 75-36-700-3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PGTT_02892
Domain Number 1 Region: 141-216
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000168
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PGTT_02892
Sequence length 266
Comment | PGTG_02892 | Puccinia graminis f. sp. tritici predicted protein (267 aa)
Sequence
MYLTINTILVERSLRLAINIRFSPGLIVHGWTPMLTKSGILVFYASSSTSAQLTKRSHFE
EEVAADYDIGRAYEDSELADRASEAAHQNCEVVAKNPGQVSPKEKLRNERWYRRRLKAIQ
DSTIKPFTRSIERIKGLLSKKVRLKSDLDSCRICFEEYKYDEPGTLLLVFPGCGEVFHES
CLTRWLDESPCIESVFRHTLACPTCRRQAPTKHGLRFFGALTSYHRNGILLINLHIALFL
LVLFLMREAIIRNSSPQKCELYALLM
Download sequence
Identical sequences PGTT_02892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]